Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZMAT5 Rabbit Polyclonal Antibody (HRP)

ZMAT5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZC3H19, SNRNP20, U11/U12-20K

UniProt

Q9UDW3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZMAT5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_005261740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque GPR34 Protein, His (Fc)-Avi-tagged
GPR34-1773R 50 µg

Recombinant Rhesus Macaque GPR34 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
JAG1  polyclonal antibody
BS79774 50ul

JAG1 polyclonal antibody

Sign In for Pricing
View Details
Translation initiation Factor eIF-2B subunit β (EIF2B2) Bovine ELISA Kit
H7832 96 Tests

Translation initiation Factor eIF-2B subunit β (EIF2B2) Bovine ELISA Kit

Sign In for Pricing
View Details
EV450 Anti-Mouse CD107a Antibody
JOT23104F 20Tests

EV450 Anti-Mouse CD107a Antibody

Sign In for Pricing
View Details
Human C14orf105 knockdown cell line
ABC-KD1726 1 Vial

Human C14orf105 knockdown cell line

Sign In for Pricing
View Details
NDUFA7 Antibody
orb1323473 100 µL

NDUFA7 Antibody

Sign In for Pricing
View Details