Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZMAT5 Rabbit Polyclonal Antibody (HRP)

ZMAT5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZC3H19, SNRNP20, U11/U12-20K

UniProt

Q9UDW3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZMAT5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_005261740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GJB1 (Gap Junction beta-1 Protein, Connexin-32, Cx32, GAP Junction 28kD Liver Protein, CX32) (AP)
MBS6131470-01 0.1 mL

GJB1 (Gap Junction beta-1 Protein, Connexin-32, Cx32, GAP Junction 28kD Liver Protein, CX32) (AP)

Sign In for Pricing
View Details
GJB1 (Gap Junction beta-1 Protein, Connexin-32, Cx32, GAP Junction 28kD Liver Protein, CX32) (AP)
MBS6131470-02 5x 0.1 mL

GJB1 (Gap Junction beta-1 Protein, Connexin-32, Cx32, GAP Junction 28kD Liver Protein, CX32) (AP)

Sign In for Pricing
View Details
RGD1309922 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV641575 1.0 µg DNA

RGD1309922 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Immunoglobulin A (IgA) ELISA Kit
MBS266279-01 48 Well

Human Immunoglobulin A (IgA) ELISA Kit

Sign In for Pricing
View Details
Human Immunoglobulin A (IgA) ELISA Kit
MBS266279-02 96 Well

Human Immunoglobulin A (IgA) ELISA Kit

Sign In for Pricing
View Details
Human Immunoglobulin A (IgA) ELISA Kit
MBS266279-03 5x 96 Well

Human Immunoglobulin A (IgA) ELISA Kit

Sign In for Pricing
View Details