Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irgc1 Rabbit Polyclonal Antibody (Biotin)

Irgc1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ii, Irgc, Gm474, Ifgge, Iigp5, Gm1102, F630044M05Rik

UniProt

Q8C262

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RGLGAEDPGAALTGVVETTMQPSPYPHPQFPDVTLWDLPGAGSPGCSADK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_950178

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRP5 shRNA Plasmid (h)
sc-77053-SH 20 µg

CTRP5 shRNA Plasmid (h)

Sign In for Pricing
View Details
Zfp777 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4994003 1.0 µg DNA

Zfp777 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
ITGA7 Polyclonal Antibody, PE Conjugated
bs-23229R-PE 100 µL

ITGA7 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Human MYCL Protein, N-GST & C-His
AP97633 50 µg

Recombinant Human MYCL Protein, N-GST & C-His

Sign In for Pricing
View Details
Lentiviral mouse Bbs10 shRNA (UAS) - Lentiviral mouse Bbs10 shRNA (UAS) (100)
GTR15181374 1 Vial

Lentiviral mouse Bbs10 shRNA (UAS) - Lentiviral mouse Bbs10 shRNA (UAS) (100)

Sign In for Pricing
View Details
Mouse Monoclonal MHC Class II RT1B Antibody (OX-6) [DyLight 405]
NB100-65541V 0.25 mL

Mouse Monoclonal MHC Class II RT1B Antibody (OX-6) [DyLight 405]

Sign In for Pricing
View Details