Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irgc1 Rabbit Polyclonal Antibody (Biotin)

Irgc1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ii, Irgc, Gm474, Ifgge, Iigp5, Gm1102, F630044M05Rik

UniProt

Q8C262

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RGLGAEDPGAALTGVVETTMQPSPYPHPQFPDVTLWDLPGAGSPGCSADK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_950178

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CRYZL1 Antibody (OTI2F9) [PerCP]
NBP2-71522PCP 0.1 mL

Mouse Monoclonal CRYZL1 Antibody (OTI2F9) [PerCP]

Sign In for Pricing
View Details
2HT-500-2-BK-S AB Labels
114337 Roll of 250 Label(s)

2HT-500-2-BK-S AB Labels

Sign In for Pricing
View Details
Mouse Monoclonal HLA G Antibody (MEM-G/1) [Alexa Fluor 532]
NB500-302AF532 0.1 mL

Mouse Monoclonal HLA G Antibody (MEM-G/1) [Alexa Fluor 532]

Sign In for Pricing
View Details
Human Retinol Binding Protein 3, Interstitial ELISA Kit
MBS760587-01 48 Well

Human Retinol Binding Protein 3, Interstitial ELISA Kit

Sign In for Pricing
View Details
Human Retinol Binding Protein 3, Interstitial ELISA Kit
MBS760587-02 96 Well

Human Retinol Binding Protein 3, Interstitial ELISA Kit

Sign In for Pricing
View Details
Human Retinol Binding Protein 3, Interstitial ELISA Kit
MBS760587-03 5x 96 Well

Human Retinol Binding Protein 3, Interstitial ELISA Kit

Sign In for Pricing
View Details