Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4ENIF1 Rabbit Polyclonal Antibody (Biotin)

EIF4ENIF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

4E-T, Clast4

UniProt

Q9NRA8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4ENIF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_062817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SDAD1 Antibody [DyLight 350]
NBP2-98637UV 0.1 mL

Rabbit Polyclonal SDAD1 Antibody [DyLight 350]

Sign In for Pricing
View Details
CLEC2B (AICL, CLECSF2, IFNRG1, C-type Lectin Domain Family 2 Member B, Activation-induced C-type Lectin, C-type Lectin Superfamily Member 2, IFN-alpha-2b-inducing-related Protein 1) (MaxLight 750)
MBS6232199-01 0.1 mL

CLEC2B (AICL, CLECSF2, IFNRG1, C-type Lectin Domain Family 2 Member B, Activation-induced C-type Lectin, C-type Lectin Superfamily Member 2, IFN-alpha-2b-inducing-related Protein 1) (MaxLight 750)

Sign In for Pricing
View Details
CLEC2B (AICL, CLECSF2, IFNRG1, C-type Lectin Domain Family 2 Member B, Activation-induced C-type Lectin, C-type Lectin Superfamily Member 2, IFN-alpha-2b-inducing-related Protein 1) (MaxLight 750)
MBS6232199-02 5x 0.1 mL

CLEC2B (AICL, CLECSF2, IFNRG1, C-type Lectin Domain Family 2 Member B, Activation-induced C-type Lectin, C-type Lectin Superfamily Member 2, IFN-alpha-2b-inducing-related Protein 1) (MaxLight 750)

Sign In for Pricing
View Details
C12orf11 Double Nickase Plasmid (h2)
sc-412584-NIC-2 20 µg

C12orf11 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
CEACAM15 CRISPR Activation Plasmid (m)
sc-430370-ACT 20 µg

CEACAM15 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Multiplex Assay Kit for Protein Tyrosine Kinase 6 (PTK6), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0030311 96 Tests

Multiplex Assay Kit for Protein Tyrosine Kinase 6 (PTK6), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details