Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSTL5 Rabbit Polyclonal Antibody (HRP)

FSTL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp566D234, KIAA1263

UniProt

Q8N475

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FSTL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001121900

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMA3C Polyclonal Antibody
MBS9135372-01 0.02 mL

SEMA3C Polyclonal Antibody

Sign In for Pricing
View Details
SEMA3C Polyclonal Antibody
MBS9135372-02 0.1 mL

SEMA3C Polyclonal Antibody

Sign In for Pricing
View Details
SEMA3C Polyclonal Antibody
MBS9135372-03 5x 0.1 mL

SEMA3C Polyclonal Antibody

Sign In for Pricing
View Details
CD168 Polyclonal Antibody
UB-GEN-13555 100 µL

CD168 Polyclonal Antibody

Sign In for Pricing
View Details
MIS12 (Protein MIS12 Homolog, MIS12, MIND Kinetochore Complex Component, Homolog (S. Pombe)
485852 100 µL

MIS12 (Protein MIS12 Homolog, MIS12, MIND Kinetochore Complex Component, Homolog (S. Pombe)

Sign In for Pricing
View Details
Human FAP Pre-designed siRNA Set A
SI005473A 1 Each

Human FAP Pre-designed siRNA Set A

Sign In for Pricing
View Details