Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBQLN4 Rabbit Polyclonal Antibody (Biotin)

UBQLN4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

A1U, A1Up, UBIN, CIP75, C1orf6

UniProt

Q9NRR5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human UBQLN4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QNPESLSILTNPRAMQALLQIQQGLQTLQTEAPGLVPSLGSFGMSRTPAP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001291271.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC1 recombinant monoclonal antibody
A5723 100ul X 3

HDAC1 recombinant monoclonal antibody

Sign In for Pricing
View Details
TPA and PAI-1 Deficient Plasma
MBS514030 3x 1 mL

TPA and PAI-1 Deficient Plasma

Sign In for Pricing
View Details
C5orf54 Protein Vector (Human) (pPB-N-His)
PV006602 500 ng

C5orf54 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615) (HRP)
129479-HRP 100 µL

MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615) (HRP)

Sign In for Pricing
View Details
Olfr967 siRNA (m)
sc-151267 10 µM

Olfr967 siRNA (m)

Sign In for Pricing
View Details
CENPI Rabbit Polyclonal Antibody (BF750)
orb2520856 100 µL

CENPI Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details