Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBQLN4 Rabbit Polyclonal Antibody (HRP)

UBQLN4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A1U, A1Up, UBIN, CIP75, C1orf6

UniProt

Q9NRR5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human UBQLN4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QNPESLSILTNPRAMQALLQIQQGLQTLQTEAPGLVPSLGSFGMSRTPAP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001291271.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB3D, CT (RAB3D, GOV, RAB16, Ras-related protein Rab-3D) (AP)
MBS6339778-01 0.2 mL

RAB3D, CT (RAB3D, GOV, RAB16, Ras-related protein Rab-3D) (AP)

Sign In for Pricing
View Details
RAB3D, CT (RAB3D, GOV, RAB16, Ras-related protein Rab-3D) (AP)
MBS6339778-02 5x 0.2 mL

RAB3D, CT (RAB3D, GOV, RAB16, Ras-related protein Rab-3D) (AP)

Sign In for Pricing
View Details
FAUC 346
M24423-01 1 g

FAUC 346

Sign In for Pricing
View Details
FAUC 346
M24423-02 500 mg

FAUC 346

Sign In for Pricing
View Details
FAUC 346
M24423-03 2 mg

FAUC 346

Sign In for Pricing
View Details
FAUC 346
M24423-04 5 mg

FAUC 346

Sign In for Pricing
View Details