Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBQLN4 Rabbit Polyclonal Antibody (HRP)

UBQLN4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A1U, A1Up, UBIN, CIP75, C1orf6

UniProt

Q9NRR5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human UBQLN4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QNPESLSILTNPRAMQALLQIQQGLQTLQTEAPGLVPSLGSFGMSRTPAP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001291271.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YBX1P4 Recombinant Protein (Human)
RP108008 100 µg

YBX1P4 Recombinant Protein (Human)

Sign In for Pricing
View Details
TLR7 Antibody
CSB-PA138308-01 50 μL

TLR7 Antibody

Sign In for Pricing
View Details
TLR7 Antibody
CSB-PA138308-02 100 µL

TLR7 Antibody

Sign In for Pricing
View Details
PREX1 Rabbit Polyclonal Antibody
orb1743966 100 µg

PREX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNFRSF1B (TNF Receptor II, Tumor Necrosis Factor Receptor Superfamily Member 1B, TNFRSF1B, Tnfr2)
303677 100 µg

TNFRSF1B (TNF Receptor II, Tumor Necrosis Factor Receptor Superfamily Member 1B, TNFRSF1B, Tnfr2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Cathelicidin Antimicrobial Peptide (CAMP)
MBS2065576-01 0.1 mL

HRP-Linked Polyclonal Antibody to Cathelicidin Antimicrobial Peptide (CAMP)

Sign In for Pricing
View Details