Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BDH2 Rabbit Polyclonal Antibody (HRP)

BDH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DHRS6, EFA6R, SDR15C1, UCPA-OR, UNQ6308, PRO20933

UniProt

Q9BUT1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BDH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064524

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

V6 Human IgG1-Lambda1 Isotype control
B646501-01 1 mg

V6 Human IgG1-Lambda1 Isotype control

Sign In for Pricing
View Details
V6 Human IgG1-Lambda1 Isotype control
B646501-02 5 mg

V6 Human IgG1-Lambda1 Isotype control

Sign In for Pricing
View Details
V6 Human IgG1-Lambda1 Isotype control
B646501-03 25 mg

V6 Human IgG1-Lambda1 Isotype control

Sign In for Pricing
View Details
V6 Human IgG1-Lambda1 Isotype control
B646501-04 50 mg

V6 Human IgG1-Lambda1 Isotype control

Sign In for Pricing
View Details
V6 Human IgG1-Lambda1 Isotype control
B646501-05 100 mg

V6 Human IgG1-Lambda1 Isotype control

Sign In for Pricing
View Details
HIGD2A, NT (HIGD2A, HIG1 domain family member 2A) (FITC) discontinued
036556-FITC 200 µL

HIGD2A, NT (HIGD2A, HIG1 domain family member 2A) (FITC) discontinued

Sign In for Pricing
View Details