Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMCES Rabbit Polyclonal Antibody (HRP)

HMCES Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DC12, SRAPD1, C3orf37

UniProt

Q96FZ2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMCES

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMR

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_005247693

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF1 Antibody
V7358SAF-100UG 100 µg

TRAF1 Antibody

Sign In for Pricing
View Details
VEGF Receptor 1/FLT1 Rabbit Polyclonal Antibody (Fluoro594)
orb3117938 100 µg

VEGF Receptor 1/FLT1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
IRAK4 (Interleukin-1 Receptor-Associated Kinase 4, IPD1, NY-REN-64, REN64) (MaxLight 750)
MBS6238995-01 0.1 mL

IRAK4 (Interleukin-1 Receptor-Associated Kinase 4, IPD1, NY-REN-64, REN64) (MaxLight 750)

Sign In for Pricing
View Details
IRAK4 (Interleukin-1 Receptor-Associated Kinase 4, IPD1, NY-REN-64, REN64) (MaxLight 750)
MBS6238995-02 5x 0.1 mL

IRAK4 (Interleukin-1 Receptor-Associated Kinase 4, IPD1, NY-REN-64, REN64) (MaxLight 750)

Sign In for Pricing
View Details
Human Resolvin E2 (RvE2) ELISA Kit
MBS3801485-01 48 Well

Human Resolvin E2 (RvE2) ELISA Kit

Sign In for Pricing
View Details
Human Resolvin E2 (RvE2) ELISA Kit
MBS3801485-02 96 Well

Human Resolvin E2 (RvE2) ELISA Kit

Sign In for Pricing
View Details