Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMCES Rabbit Polyclonal Antibody (HRP)

HMCES Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, Srap1, C85376, 8430410A17Rik

UniProt

Q8R1M0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SYNKSPQSSSPVLLSRLHFEKDADSSDRIIIPMRWGLVPSWFKESDPSKL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_776098

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CBL Antibody Picoband® (Dylight488 Conjugate)
PB9077-Dylight488 100 µg

Anti-CBL Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Beta-Cyclogeranyltriphenylphosphonium Bromide-d5
TRC-C987852-5MG 5 mg

Beta-Cyclogeranyltriphenylphosphonium Bromide-d5

Sign In for Pricing
View Details
Anti-Prolactin (PRL) Mouse Monoclonal Antibody [Clone ID: OTI6B1]
M00601-1 100 µL

Anti-Prolactin (PRL) Mouse Monoclonal Antibody [Clone ID: OTI6B1]

Sign In for Pricing
View Details
Exgene Tissue SV plus!
109-101 100 Units

Exgene Tissue SV plus!

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Phosphoglycerate Mutase 2, Muscle (PGAM2)
MBS2093579-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Phosphoglycerate Mutase 2, Muscle (PGAM2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Phosphoglycerate Mutase 2, Muscle (PGAM2)
MBS2093579-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Phosphoglycerate Mutase 2, Muscle (PGAM2)

Sign In for Pricing
View Details