Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMCES Rabbit Polyclonal Antibody (HRP)

HMCES Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, Srap1, C85376, 8430410A17Rik

UniProt

Q8R1M0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SYNKSPQSSSPVLLSRLHFEKDADSSDRIIIPMRWGLVPSWFKESDPSKL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_776098

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pax-5 rabbit pAb Antibody
orb766917-01 50 μL

Pax-5 rabbit pAb Antibody

Sign In for Pricing
View Details
Pax-5 rabbit pAb Antibody
orb766917-02 100 µL

Pax-5 rabbit pAb Antibody

Sign In for Pricing
View Details
Serum-Free Cell Freeze (Phenol Red Free)
C2954-01 50 mL

Serum-Free Cell Freeze (Phenol Red Free)

Sign In for Pricing
View Details
Serum-Free Cell Freeze (Phenol Red Free)
C2954-02 100 mL

Serum-Free Cell Freeze (Phenol Red Free)

Sign In for Pricing
View Details
MOCOS Rabbit Polyclonal Antibody (BF555)
orb2407326 100 µL

MOCOS Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Goat IgG Secondary antibody Clone: pAb to UltraPolymer Goat Anti-Human IgG (H&L) HRP
A1278-5 5 ml

Goat IgG Secondary antibody Clone: pAb to UltraPolymer Goat Anti-Human IgG (H&L) HRP

Sign In for Pricing
View Details