Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDR39U1 Rabbit Polyclonal Antibody (FITC)

SDR39U1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HCDI, C14orf124

UniProt

Q9NRG7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SDR39U1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KAWVLVTGVAYYQPSLTAEYDEDSPGGDFDFFSNLVTKWEAAARLPGDST

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064580

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRD7P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
13464061 1.0 µg DNA

BRD7P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Mouse SLC38A9 Protein, His (Fc)-Avi-tagged
SLC38A9-8360M 50 µg

Recombinant Mouse SLC38A9 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Phosphatase nudJ (nudJ)
MBS1160915-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC Phosphatase nudJ (nudJ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Phosphatase nudJ (nudJ)
MBS1160915-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC Phosphatase nudJ (nudJ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Phosphatase nudJ (nudJ)
MBS1160915-03 0.02 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC Phosphatase nudJ (nudJ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Phosphatase nudJ (nudJ)
MBS1160915-04 0.1 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC Phosphatase nudJ (nudJ)

Sign In for Pricing
View Details