Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5M Rabbit Polyclonal Antibody (Biotin)

NT5M Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MdN, dNT2, dNT-2

UniProt

Q9NPB1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NT5M

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064586

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

50mL Centrifugal Filters, Nylon, 0.45μm
FC050-NY-45 1 Package

50mL Centrifugal Filters, Nylon, 0.45μm

Sign In for Pricing
View Details
ADAM11, NT (ADAM11, MDC, Disintegrin and metalloproteinase domain-containing protein 11, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein) (MaxLight 405)
MBS6271491-01 0.1 mL

ADAM11, NT (ADAM11, MDC, Disintegrin and metalloproteinase domain-containing protein 11, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein) (MaxLight 405)

Sign In for Pricing
View Details
ADAM11, NT (ADAM11, MDC, Disintegrin and metalloproteinase domain-containing protein 11, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein) (MaxLight 405)
MBS6271491-02 5x 0.1 mL

ADAM11, NT (ADAM11, MDC, Disintegrin and metalloproteinase domain-containing protein 11, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein) (MaxLight 405)

Sign In for Pricing
View Details
Phospho-Smad2 (Ser467) Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1607794 100 µL

Phospho-Smad2 (Ser467) Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
RAB11FIP5 Antibody
MBS9419560-01 0.05 mL

RAB11FIP5 Antibody

Sign In for Pricing
View Details
RAB11FIP5 Antibody
MBS9419560-02 0.1 mL

RAB11FIP5 Antibody

Sign In for Pricing
View Details