Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5M Rabbit Polyclonal Antibody (FITC)

NT5M Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MdN, dNT2, dNT-2

UniProt

Q9NPB1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NT5M

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064586

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CED6 Antibody (Biotin Conjugate)
33341-05121 150 µg

Human CED6 Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
SFRP4, Recombinant, Human (Secreted Frizzled Related Protein 4, DDC-4, FrpAP, frpHE, FrzB-2) (BSA Free)
S1012-89RX 25 µg

SFRP4, Recombinant, Human (Secreted Frizzled Related Protein 4, DDC-4, FrpAP, frpHE, FrzB-2) (BSA Free)

Sign In for Pricing
View Details
Rabbit Polyclonal ROBLD3 Antibody [Alexa Fluor 405]
NBP2-81696AF405 0.1 mL

Rabbit Polyclonal ROBLD3 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
NECAB1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV690510 1.0 µg DNA

NECAB1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Kctd1 (NM_134112) Mouse Tagged ORF Clone Lentiviral Particle
MR215954L4V 200 µL

Kctd1 (NM_134112) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS800033 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details