Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5M Rabbit Polyclonal Antibody (HRP)

NT5M Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MdN, dNT2, dNT-2

UniProt

Q9NPB1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NT5M

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064586

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERP29 CRISPRa sgRNA lentivector (set of three targets)(Human)
19443121 3x 1.0µg DNA

ERP29 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
TAOK2 (TAO Kinase 2, KIAA0881, MAP3K17, PSK, PSK1, TAO1, TAO2) (APC)
252369-APC 100 µL

TAOK2 (TAO Kinase 2, KIAA0881, MAP3K17, PSK, PSK1, TAO1, TAO2) (APC)

Sign In for Pricing
View Details
MAP126 (SPAG5) Mouse Monoclonal Antibody [Clone ID: OTI2F2]
TA810449S 30 µL

MAP126 (SPAG5) Mouse Monoclonal Antibody [Clone ID: OTI2F2]

Sign In for Pricing
View Details
Olfr293 (NM_001011752) Mouse Tagged ORF Clone
MG213263 10 µg

Olfr293 (NM_001011752) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
C3orf39 siRNA Oligos set (Human)
14481171 3x 5 nmol

C3orf39 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Lentiviral mouse Acot3 shRNA (UAS) - Lentiviral mouse Acot3 shRNA (UAS, RFP) plasmid
GTR15261685 1 Vial

Lentiviral mouse Acot3 shRNA (UAS) - Lentiviral mouse Acot3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details