Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnpep Rabbit Polyclonal Antibody (HRP)

Rnpep Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

E9PYF1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rnpep

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TCLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001153096

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QA / Complement C1q A-Chain (C1QA/2952), CF405S conjugate, 0.1mg/mL
BNC042952-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2952), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (Ks19.1), 0.2mg/mL
BNUB0394-100 1x 100 µL

Cytokeratin 19 (Ks19.1), 0.2mg/mL

Sign In for Pricing
View Details
Mouse Gnai2 activation kit by CRISPRa
GA201649 1 Kit

Mouse Gnai2 activation kit by CRISPRa

Sign In for Pricing
View Details
SETDB2 (NM_001160308) Human Over-expression Lysate
LC432029 20 µg

SETDB2 (NM_001160308) Human Over-expression Lysate

Sign In for Pricing
View Details
Aurora A (AURKA) Rabbit Polyclonal Antibody
TA371224 100 µL

Aurora A (AURKA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS803797 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details