Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C17orf48 Rabbit Polyclonal Antibody (HRP)

C17orf48 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MDS006, C17orf48, NBLA03831

UniProt

Q3LIE5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C17orf48

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_064618

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

gamma Catenin (JUP) Mouse Monoclonal Antibody [Clone ID: CN-3]
AM20592PU-N 100 µg

gamma Catenin (JUP) Mouse Monoclonal Antibody [Clone ID: CN-3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS500726 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Troponin I fast skeletal muscle (TNNI2) (NM_001145829) Human Over-expression Lysate
LC429022 20 µg

Troponin I fast skeletal muscle (TNNI2) (NM_001145829) Human Over-expression Lysate

Sign In for Pricing
View Details
NOSTRIN (NM_001039724) Human Recombinant Protein
TP310661M 100 µg

NOSTRIN (NM_001039724) Human Recombinant Protein

Sign In for Pricing
View Details
ZNF518A Human Gene Knockout Kit (CRISPR)
KN419588 1 Kit

ZNF518A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zfp300 Mouse Gene Knockout Kit (CRISPR)
KN519781 1 Kit

Zfp300 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details