Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDXP Rabbit Polyclonal Antibody (HRP)

PDXP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CIN, PLP, dJ37E16.5

UniProt

Q96GD0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PDXP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_064711

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRUNOL5 Rabbit Polyclonal Antibody
orb324918 100 µL

BRUNOL5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human AASDHPPT ELISA Kit (Ready to Use)
orb549797-01 48 Tests

Human AASDHPPT ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human AASDHPPT ELISA Kit (Ready to Use)
orb549797-02 96 Tests

Human AASDHPPT ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Recombinant Human DVL2 Protein, N-His
AP90075 50 µg

Recombinant Human DVL2 Protein, N-His

Sign In for Pricing
View Details
Paxenopus6 (Paired Boxenopus Protein Paxenopus-6, Oculorhombin, Paxenopus6, Paxenopus-6, Sey) (MaxLight 550) discontinued
302635-ML550 100 µL

Paxenopus6 (Paired Boxenopus Protein Paxenopus-6, Oculorhombin, Paxenopus6, Paxenopus-6, Sey) (MaxLight 550) discontinued

Sign In for Pricing
View Details
CDKN2A/p19ARF Rabbit Polyclonal Antibody (BF750)
orb2541285 100 µL

CDKN2A/p19ARF Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details