Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDXP Rabbit Polyclonal Antibody (HRP)

PDXP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CIN, PLP, dJ37E16.5

UniProt

Q96GD0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PDXP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_064711

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krtap1-5 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6229904 1.0 µg DNA

Krtap1-5 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Cytochrome P450 11B2 (CYP11B2) Antibody (FITC)
abx315658-01 20 µg

Cytochrome P450 11B2 (CYP11B2) Antibody (FITC)

Sign In for Pricing
View Details
Cytochrome P450 11B2 (CYP11B2) Antibody (FITC)
abx315658-02 50 µg

Cytochrome P450 11B2 (CYP11B2) Antibody (FITC)

Sign In for Pricing
View Details
Cytochrome P450 11B2 (CYP11B2) Antibody (FITC)
abx315658-03 100 µg

Cytochrome P450 11B2 (CYP11B2) Antibody (FITC)

Sign In for Pricing
View Details
Cytochrome P450 11B2 (CYP11B2) Antibody (FITC)
abx315658-04 200 µg

Cytochrome P450 11B2 (CYP11B2) Antibody (FITC)

Sign In for Pricing
View Details
Cytochrome P450 11B2 (CYP11B2) Antibody (FITC)
abx315658-05 1 mg

Cytochrome P450 11B2 (CYP11B2) Antibody (FITC)

Sign In for Pricing
View Details