Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKMY2 Rabbit Polyclonal Antibody (Biotin)

ANKMY2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZMYND20

UniProt

Q8IV38

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ANKMY2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064715

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin 4 Induced Protein 1 (IL4I1) ELISA Kit
MBS9309248-01 48 Well

Human Interleukin 4 Induced Protein 1 (IL4I1) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 4 Induced Protein 1 (IL4I1) ELISA Kit
MBS9309248-02 96 Well

Human Interleukin 4 Induced Protein 1 (IL4I1) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 4 Induced Protein 1 (IL4I1) ELISA Kit
MBS9309248-03 5x 96 Well

Human Interleukin 4 Induced Protein 1 (IL4I1) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 4 Induced Protein 1 (IL4I1) ELISA Kit
MBS9309248-04 10x 96 Well

Human Interleukin 4 Induced Protein 1 (IL4I1) ELISA Kit

Sign In for Pricing
View Details
EPAS1, NT (EPAS1, BHLHE73, HIF2A, MOP2, PASD2, Endothelial PAS domain-containing protein 1, Basic-helix-loop-helix-PAS protein MOP2, Class E basic helix-loop-helix protein 73, HIF-1-alpha-like factor, Hypoxia-inducible factor 2-alpha, Member of PAS protei
MBS6295861-01 0.1 mL

EPAS1, NT (EPAS1, BHLHE73, HIF2A, MOP2, PASD2, Endothelial PAS domain-containing protein 1, Basic-helix-loop-helix-PAS protein MOP2, Class E basic helix-loop-helix protein 73, HIF-1-alpha-like factor, Hypoxia-inducible factor 2-alpha, Member of PAS protei

Sign In for Pricing
View Details
EPAS1, NT (EPAS1, BHLHE73, HIF2A, MOP2, PASD2, Endothelial PAS domain-containing protein 1, Basic-helix-loop-helix-PAS protein MOP2, Class E basic helix-loop-helix protein 73, HIF-1-alpha-like factor, Hypoxia-inducible factor 2-alpha, Member of PAS protei
MBS6295861-02 5x 0.1 mL

EPAS1, NT (EPAS1, BHLHE73, HIF2A, MOP2, PASD2, Endothelial PAS domain-containing protein 1, Basic-helix-loop-helix-PAS protein MOP2, Class E basic helix-loop-helix protein 73, HIF-1-alpha-like factor, Hypoxia-inducible factor 2-alpha, Member of PAS protei

Sign In for Pricing
View Details