Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd50 Rabbit Polyclonal Antibody (Biotin)

Ankrd50 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1311665

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LQPSLRGLPNGPAHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNSSLRTT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

156kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001178535

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-HMCES Antibody, Affinity Purified
A305-867A 100 µg

Rabbit anti-HMCES Antibody, Affinity Purified

Sign In for Pricing
View Details
METAP2 (N-term) Rabbit pAb
E2612718 100 µL

METAP2 (N-term) Rabbit pAb

Sign In for Pricing
View Details
Mouse Cathepsin K (CTSK) CLIA Kit
abx195497-01 96 Tests

Mouse Cathepsin K (CTSK) CLIA Kit

Sign In for Pricing
View Details
Mouse Cathepsin K (CTSK) CLIA Kit
abx195497-02 5x 96 Tests

Mouse Cathepsin K (CTSK) CLIA Kit

Sign In for Pricing
View Details
Mouse Cathepsin K (CTSK) CLIA Kit
abx195497-03 10x 96 Tests

Mouse Cathepsin K (CTSK) CLIA Kit

Sign In for Pricing
View Details
SRrp35 Adenovirus (Human)
45508051 1.0 mL

SRrp35 Adenovirus (Human)

Sign In for Pricing
View Details