Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd50 Rabbit Polyclonal Antibody (FITC)

Ankrd50 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RGD1311665

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LQPSLRGLPNGPAHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNSSLRTT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

156kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001178535

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TSH beta Antibody (154) [Janelia Fluor 646]
NB100-62385JF646 0.5 mL

Mouse Monoclonal TSH beta Antibody (154) [Janelia Fluor 646]

Sign In for Pricing
View Details
Mouse ANO10 shRNA Plasmid
abx979547-01 150 µg

Mouse ANO10 shRNA Plasmid

Sign In for Pricing
View Details
Mouse ANO10 shRNA Plasmid
abx979547-02 300 µg

Mouse ANO10 shRNA Plasmid

Sign In for Pricing
View Details
Mouse Hydroxyacylglutathione hydrolase, Mitochondrial ELISA kit
GTR10375852 96 Well

Mouse Hydroxyacylglutathione hydrolase, Mitochondrial ELISA kit

Sign In for Pricing
View Details
RPL21P79 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1930408 1.0 µg DNA

RPL21P79 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart) BioAssayTM ELISA Kit (Mouse) discontinued
382812 96 Tests

FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details