Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd50 Rabbit Polyclonal Antibody (FITC)

Ankrd50 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RGD1311665

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LQPSLRGLPNGPAHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNSSLRTT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

156kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001178535

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ UV460 Anti-human CD206 Antibody *15-2*
120600Y0-AAT 100 Tests

MFluor™ UV460 Anti-human CD206 Antibody *15-2*

Sign In for Pricing
View Details
Guanfacine . HCl
BML-AR102-0500 500 mg

Guanfacine . HCl

Sign In for Pricing
View Details
TIM-3/HAVCR2/CD366 Antibody
orb1805899-01 100 µg

TIM-3/HAVCR2/CD366 Antibody

Sign In for Pricing
View Details
TIM-3/HAVCR2/CD366 Antibody
orb1805899-02 1 mg

TIM-3/HAVCR2/CD366 Antibody

Sign In for Pricing
View Details
PRR18 Protein Vector (Human) (pPB-N-His)
PV113447 500 ng

PRR18 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PHAP1, NT (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member A, Acidic Nuclear Phosphoprotein pp32, Leucine-rich Acidic Nuclear Protein, LANP, Mapmodulin, Potent Heat-stable Protein Phosphatase 2A Inhibitor I1PP2A, Putative HLA-DR-associated Pro
MBS6002655-01 0.05 mg

PHAP1, NT (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member A, Acidic Nuclear Phosphoprotein pp32, Leucine-rich Acidic Nuclear Protein, LANP, Mapmodulin, Potent Heat-stable Protein Phosphatase 2A Inhibitor I1PP2A, Putative HLA-DR-associated Pro

Sign In for Pricing
View Details