Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Camk1d Rabbit Polyclonal Antibody (Biotin)

Camk1d Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CKL, CKLiK, CaMKId, mCKLiK, CaMKIdelta, A630059D12Rik, E030025C11Rik

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Camk1d

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIY

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_796317

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS7 Antibody
8C18326-AAT 50 µg

RGS7 Antibody

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker), CF594 conjugate, 0.1mg/mL
BNC941774-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Di-tert-butyl Ether
TRC-D427235-500MG 500 mg

Di-tert-butyl Ether

Sign In for Pricing
View Details
ANKRD24 Human Gene Knockout Kit (CRISPR)
KN423342 1 Kit

ANKRD24 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CF®770, Succinimidyl Ester
#92150 1x 1 µmol

CF®770, Succinimidyl Ester

Sign In for Pricing
View Details
ACAA1 (NM_001607) Human Over-expression Lysate
LY400605 100 µg

ACAA1 (NM_001607) Human Over-expression Lysate

Sign In for Pricing
View Details