Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Camk1d Rabbit Polyclonal Antibody (FITC)

Camk1d Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CKL, CKLiK, CaMKId, mCKLiK, CaMKIdelta, A630059D12Rik, E030025C11Rik

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Camk1d

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIY

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_796317

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGC94190 ORF Vector (Rat) (pORF)
ORF070557 1.0 µg DNA

MGC94190 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Glia Maturation Factor Beta GMFb ELISA Kit
BG-MUS11093 1 Each

Mouse Glia Maturation Factor Beta GMFb ELISA Kit

Sign In for Pricing
View Details
Bucket Specimen 2.5L Polypropylene with Lid White
BUC2007 10 / PCK

Bucket Specimen 2.5L Polypropylene with Lid White

Sign In for Pricing
View Details
Rat Cholecystokinin A Receptor (CCKAR) ELISA Kit
orb1667391-01 48 Tests

Rat Cholecystokinin A Receptor (CCKAR) ELISA Kit

Sign In for Pricing
View Details
Rat Cholecystokinin A Receptor (CCKAR) ELISA Kit
orb1667391-02 96 Tests

Rat Cholecystokinin A Receptor (CCKAR) ELISA Kit

Sign In for Pricing
View Details
Ube2L3 Rabbit Polyclonal Antibody (PerCP)
orb2384481 100 µL

Ube2L3 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details