Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lyrm4 Rabbit Polyclonal Antibody (FITC)

Lyrm4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Gm903, BC034664

UniProt

Q8K215

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_958746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tgfbr1, ID (Tgfbr1, TGF-beta receptor type-1, ESK2, Transforming growth factor-beta receptor type I) (MaxLight 550) discontinued
042780-ML550 100 µL

Tgfbr1, ID (Tgfbr1, TGF-beta receptor type-1, ESK2, Transforming growth factor-beta receptor type I) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Yes1 Mouse shRNA Lentiviral Particle (Locus ID 22612)
TL516206V 500 µL Each

Yes1 Mouse shRNA Lentiviral Particle (Locus ID 22612)

Sign In for Pricing
View Details
Lentiviral human GLOD4 shRNA (UAS) - Lentiviral human GLOD4 shRNA (UAS, RFP) (100)
GTR15342543 1 Vial

Lentiviral human GLOD4 shRNA (UAS) - Lentiviral human GLOD4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
RBBP4/RbAp48 Overexpression Lysate (Native) - (Dry Ice)
NBL1-15185 0.1 mg

RBBP4/RbAp48 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
MIR486 Human MicroRNA Expression Plasmid (MI0002470)
SC400412 10 µg

MIR486 Human MicroRNA Expression Plasmid (MI0002470)

Sign In for Pricing
View Details
Recombinant human HLA-B protein
OPCA01061-1MG 1 mg

Recombinant human HLA-B protein

Sign In for Pricing
View Details