Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHMP1B Rabbit Polyclonal Antibody (HRP)

CHMP1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Vps46B, C10orf2, C18orf2, CHMP1.5, Vps46-2, C18-ORF2, hVps46-2

UniProt

Q7LBR1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHMP1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065145

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trypsin inhibitor DE-3 Antibody (FITC)
orb28465-01 50 µg

Trypsin inhibitor DE-3 Antibody (FITC)

Sign In for Pricing
View Details
Trypsin inhibitor DE-3 Antibody (FITC)
orb28465-02 100 µg

Trypsin inhibitor DE-3 Antibody (FITC)

Sign In for Pricing
View Details
Anti-Human CD83 Antibody (60B10), PerCP
FHF85914 100 Tests

Anti-Human CD83 Antibody (60B10), PerCP

Sign In for Pricing
View Details
Culture Medium for Human Pancreatic Cancer Cells [Capan-02]
AFG-ELL-1286-01 125 mL

Culture Medium for Human Pancreatic Cancer Cells [Capan-02]

Sign In for Pricing
View Details
Culture Medium for Human Pancreatic Cancer Cells [Capan-02]
AFG-ELL-1286-02 500 mL

Culture Medium for Human Pancreatic Cancer Cells [Capan-02]

Sign In for Pricing
View Details
Human Platelet glycoprotein IX ELISA Kit
MBS9427896-01 96 Tests

Human Platelet glycoprotein IX ELISA Kit

Sign In for Pricing
View Details