Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Enoyl-CoA hydratase, mitochondrial (ECHS1)

Product Specifications

Product Name Alternative

(mECH) (mECH1) (Enoyl-CoA hydratase 1) (ECHS1) (Short-chain enoyl-CoA hydratase) (SCEH)

Abbreviation

Recombinant Human ECHS1 protein

Gene Name

ECHS1

UniProt

P30084

Expression Region

28-290aa

Organism

Homo sapiens (Human)

Target Sequence

ASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Converts unsaturated trans-2-enoyl-CoA species ((2E) -enoyl-CoA) to the corresponding (3S) -3hydroxyacyl-CoA species through addition of a water molecule to the double bond. Catalyzes the hydration of medium- and short-chained fatty enoyl-CoA thioesters from 4 carbons long (C4) up to C16. Has high substrate specificity for crotonyl-CoA ((2E) -butenoyl-CoA) and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA (3-methyl- (2E) -butenoyl-CoA) and methacrylyl-CoA ((2E) -2-methylpropenoyl-CoA) . Can bind tiglyl-CoA (2-methylcrotonoyl-CoA), but hydrates only a small amount of this substrate. Plays a key role in the beta-oxidation spiral of short- and medium-chain fatty acid oxidation. At a lower rate than the hydratase reaction, catalyzes the isomerase reaction of trans-3-enoyl-CoA species (such as (3E) -hexenoyl-CoA) to trans-2-enoyl-CoA species (such as (2E) -hexenoyl-CoA), which are subsequently hydrated to 3 (S) -3-hydroxyacyl-CoA species (such as (3S) -hydroxyhexanoyl-CoA) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

55 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Gallbladder
CS600336 5x 5 µm

Frozen Tissue Sections, Gallbladder

Sign In for Pricing
View Details
KRT36 Polyclonal Antibody
MBS9133781-01 0.02 mL

KRT36 Polyclonal Antibody

Sign In for Pricing
View Details
KRT36 Polyclonal Antibody
MBS9133781-02 0.05 mL

KRT36 Polyclonal Antibody

Sign In for Pricing
View Details
KRT36 Polyclonal Antibody
MBS9133781-03 0.1 mL

KRT36 Polyclonal Antibody

Sign In for Pricing
View Details
KRT36 Polyclonal Antibody
MBS9133781-04 0.2 mL

KRT36 Polyclonal Antibody

Sign In for Pricing
View Details
KRT36 Polyclonal Antibody
MBS9133781-05 5x 0.2 mL

KRT36 Polyclonal Antibody

Sign In for Pricing
View Details