Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R3B Rabbit Polyclonal Antibody (FITC)

PPP4R3B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PSY2, smk1, FLFL2, SMEK2, PP4R3B

UniProt

Q5MIZ7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human P4R3B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EYVQTFKGLKTKYEQEKDRQNQKLNSNRFRRDAKALEEDEEMWFNEDEEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIER2 (N-term) Rabbit Polyclonal Antibody
AP52697PU-N 400 µL

MIER2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (GNRHR/768), CF640R conjugate, 0.1mg/mL
BNC400768-100 1x 100 µL

GnRH-Receptor (LHRH Receptor) (GNRHR/768), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
9130023H24Rik Mouse Gene Knockout Kit (CRISPR)
KN500509 1 Kit

9130023H24Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Angiopoietin like 7 (ANGPTL7) Human Gene Knockout Kit (CRISPR)
KN400321 1 Kit

Angiopoietin like 7 (ANGPTL7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD38 Antibody[HIT2]
E-AB-F1058L-01 20 Tests

Elab Fluor® 488 Anti-Human CD38 Antibody[HIT2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD38 Antibody[HIT2]
E-AB-F1058L-02 100 Tests

Elab Fluor® 488 Anti-Human CD38 Antibody[HIT2]

Sign In for Pricing
View Details