Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R3B Rabbit Polyclonal Antibody (HRP)

PPP4R3B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Smek, Smek2, AW011752, AW557776, mKIAA1387

UniProt

Q922R5

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DSYEKFMETKKAKESEDKENLPKRASSGGFKFTFSHSPSATNGTNSTNSK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_598795

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xpo1 AAV siRNA Pooled Vector
50555166 1.0 µg

Xpo1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ELISA Flex: Human IL-29 (HRP)
3570-1H-6 For 6 Plates

ELISA Flex: Human IL-29 (HRP)

Sign In for Pricing
View Details
CDC42BPA (MRCK alpha, Mrck, Mrcka, DMPK like, DMPK-like alpha, CDC42 Binding Protein Kinase beta, CDC42-Binding Protein Kinase alpha)
324353-01 50 µg

CDC42BPA (MRCK alpha, Mrck, Mrcka, DMPK like, DMPK-like alpha, CDC42 Binding Protein Kinase beta, CDC42-Binding Protein Kinase alpha)

Sign In for Pricing
View Details
CDC42BPA (MRCK alpha, Mrck, Mrcka, DMPK like, DMPK-like alpha, CDC42 Binding Protein Kinase beta, CDC42-Binding Protein Kinase alpha)
324353-02 100 µg

CDC42BPA (MRCK alpha, Mrck, Mrcka, DMPK like, DMPK-like alpha, CDC42 Binding Protein Kinase beta, CDC42-Binding Protein Kinase alpha)

Sign In for Pricing
View Details
Rabbit anti-Homo sapiens (Human) BPHL Polyclonal Antibody
MBS9000625 Inquire

Rabbit anti-Homo sapiens (Human) BPHL Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human TFF1 Protein, N-His-SUMO
AP95212 50 µg

Recombinant Human TFF1 Protein, N-His-SUMO

Sign In for Pricing
View Details