Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PELI1 Rabbit Polyclonal Antibody (HRP)

PELI1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp686C18116, MGC50990

UniProt

Q8C669

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PELI1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065702

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV1 (Herpes Simplex Virus Type I) (N/A), CF405S conjugate, 0.1mg/mL
BNC041800-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) (N/A), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Nkain4 activation kit by CRISPRa
GA206281 1 Kit

Mouse Nkain4 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS622488 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Polyclonal Antibody to Guinea Pig IgG,  5nm
GAF-2303-5 1 mL

Colloidal Gold Conjugated Goat Polyclonal Antibody to Guinea Pig IgG, 5nm

Sign In for Pricing
View Details
Axitinib N-Oxide
TRC-A254850-10MG 10 mg

Axitinib N-Oxide

Sign In for Pricing
View Details
AKT1 pThr450 Rabbit Polyclonal Antibody
AP08031PU-S 50 µL

AKT1 pThr450 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details