Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PELI1 Rabbit Polyclonal Antibody (HRP)

PELI1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp686C18116, MGC50990

UniProt

Q8C669

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PELI1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065702

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NABP1 (NM_001031716) Human Over-expression Lysate
LC422167 20 µg

NABP1 (NM_001031716) Human Over-expression Lysate

Sign In for Pricing
View Details
Human RNF2 activation kit by CRISPRa
GA104118 1 Kit

Human RNF2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Complement Factor H (CFH) ELISA Kit
RDR-CFH-Mu-01 96 Tests

Mouse Complement Factor H (CFH) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement Factor H (CFH) ELISA Kit
RDR-CFH-Mu-02 48 Tests

Mouse Complement Factor H (CFH) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS711072 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Thimet Oligopeptidase (THOP1) (NM_003249) Human Over-expression Lysate
LY401123 100 µg

Thimet Oligopeptidase (THOP1) (NM_003249) Human Over-expression Lysate

Sign In for Pricing
View Details