Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR35 Rabbit Polyclonal Antibody (HRP)

WDR35 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CED2, IFTA1, SRTD7, FAP118, IFT121

UniProt

Q9P2L0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human WDR35

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

132kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065830

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Alkbh2 shRNA (UAS) - Lentiviral mouse Alkbh2 shRNA (UAS, RFP) plasmid
GTR15201097 1 Vial

Lentiviral mouse Alkbh2 shRNA (UAS) - Lentiviral mouse Alkbh2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
OSTM1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1598733 100 µL

OSTM1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
TFDP3 Antibody, Biotin conjugated
A57089-100UG 100 µg

TFDP3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Lentiviral mouse Mast2 shRNA (UAS) - Lentiviral mouse Mast2 shRNA (UAS, GFP) (100)
GTR15112281 1 Vial

Lentiviral mouse Mast2 shRNA (UAS) - Lentiviral mouse Mast2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Mouse Monoclonal FSH beta Antibody (FSHb/1062) [DyLight 550]
NBP2-47734R 0.1 mL

Mouse Monoclonal FSH beta Antibody (FSHb/1062) [DyLight 550]

Sign In for Pricing
View Details
Sodium/potassium-transporting ATPase subunit β-1-interacting protein 2 (NKAIN2) Human ELISA Kit
H1765 96 Tests

Sodium/potassium-transporting ATPase subunit β-1-interacting protein 2 (NKAIN2) Human ELISA Kit

Sign In for Pricing
View Details