Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP20 Rabbit Polyclonal Antibody (Biotin)

ARHGAP20 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RARHOGAP

UniProt

Q9P2F6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP20

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQAQRK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

132kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065860

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOSL1 Recombinant Protein (Mouse)
RP135002 100 µg

FOSL1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aldose Reductase Like Protein 1 (ARL1)
MBS2097098-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Aldose Reductase Like Protein 1 (ARL1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aldose Reductase Like Protein 1 (ARL1)
MBS2097098-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Aldose Reductase Like Protein 1 (ARL1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aldose Reductase Like Protein 1 (ARL1)
MBS2097098-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Aldose Reductase Like Protein 1 (ARL1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aldose Reductase Like Protein 1 (ARL1)
MBS2097098-04 1 mL

Biotin-Linked Polyclonal Antibody to Aldose Reductase Like Protein 1 (ARL1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aldose Reductase Like Protein 1 (ARL1)
MBS2097098-05 5 mL

Biotin-Linked Polyclonal Antibody to Aldose Reductase Like Protein 1 (ARL1)

Sign In for Pricing
View Details