Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP97 Rabbit Polyclonal Antibody (HRP)

CFAP97 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hmw, KIAA1430

UniProt

Q9P2B7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIAA1430

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin α (Acetyl Lys112) Rabbit Polyclonal Antibody
APRab06263-01 20 µL

Tubulin α (Acetyl Lys112) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tubulin α (Acetyl Lys112) Rabbit Polyclonal Antibody
APRab06263-02 50 µL

Tubulin α (Acetyl Lys112) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tubulin α (Acetyl Lys112) Rabbit Polyclonal Antibody
APRab06263-03 100 µL

Tubulin α (Acetyl Lys112) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tubulin α (Acetyl Lys112) Rabbit Polyclonal Antibody
APRab06263-04 200 µL

Tubulin α (Acetyl Lys112) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZCCHC9 Protein Vector (Human) (pPM-C-His)
PV047028 500 ng

ZCCHC9 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral human PLP2 shRNA (UAS) - Lentiviral human PLP2 shRNA (UAS, RFP) (25)
GTR15138203 1 Vial

Lentiviral human PLP2 shRNA (UAS) - Lentiviral human PLP2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details