Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdfy1 Rabbit Polyclonal Antibody (Biotin)

Wdfy1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Jr, Jr1, WDF1, FENS-1, ZFYVE17, mKIAA1435, 1700013B03Rik, 1700120F24Rik

UniProt

Q9DAD3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081333

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ARIH2 Antibody, Rabbit Polyclonal
MBS8100721-01 0.1 mL

Anti-ARIH2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-ARIH2 Antibody, Rabbit Polyclonal
MBS8100721-02 5x 0.1 mL

Anti-ARIH2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
RN5S125 Protein Vector (Human) (pPM-C-HA)
PV116028 500 ng

RN5S125 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Pipette Filter tips, 100 -1250 uL, Refill Natural, Sterile, DNase/RNase free - 10 x 96 un. - ABDOS
P11100 1 Each

Pipette Filter tips, 100 -1250 uL, Refill Natural, Sterile, DNase/RNase free - 10 x 96 un. - ABDOS

Sign In for Pricing
View Details
2-Fluoro-5- (trifluoromethyl) benzonitrile
417905-01 500 mg

2-Fluoro-5- (trifluoromethyl) benzonitrile

Sign In for Pricing
View Details
2-Fluoro-5- (trifluoromethyl) benzonitrile
417905-02 1 g

2-Fluoro-5- (trifluoromethyl) benzonitrile

Sign In for Pricing
View Details