Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdfy1 Rabbit Polyclonal Antibody (FITC)

Wdfy1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Jr, Jr1, WDF1, FENS-1, ZFYVE17, mKIAA1435, 1700013B03Rik, 1700120F24Rik

UniProt

Q9DAD3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081333

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human BMP7 pAb
PA4490-01 50 μL

Rabbit Anti-Human BMP7 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human BMP7 pAb
PA4490-02 100 μL

Rabbit Anti-Human BMP7 pAb

Sign In for Pricing
View Details
Recombinant ASFV Mal-050 Protein (aa 1-137)
VAng-2176Lsx-500g 500 µg

Recombinant ASFV Mal-050 Protein (aa 1-137)

Sign In for Pricing
View Details
C15orf24 Protein Vector (Human) (pPM-C-HA)
PV065687 500 ng

C15orf24 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative phospholipid:diacylglycerol acyltransferase 2 (PDAT2)
orb2922946-01 20 µg

Recombinant Arabidopsis thaliana Putative phospholipid:diacylglycerol acyltransferase 2 (PDAT2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative phospholipid:diacylglycerol acyltransferase 2 (PDAT2)
orb2922946-02 100 µg

Recombinant Arabidopsis thaliana Putative phospholipid:diacylglycerol acyltransferase 2 (PDAT2)

Sign In for Pricing
View Details