Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT9B Rabbit Polyclonal Antibody (HRP)

TRMT9B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRM9L, hTRM9L, C8orf79, KIAA1456

UniProt

Q9P272

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human K1456

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CGTGKYLKVNSQVHTVGCDYCGPLVEIARNRGCEAMVCDNLNLPFRDEGF

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_006716434

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-[3- (4-Hydroxyphenylethylamino) butyl]phenol

sc-488438 100 mg

4-[3- (4-Hydroxyphenylethylamino) butyl]phenol

Sign In for Pricing

ADAL Antibody

57-162 400 µL

ADAL Antibody

Sign In for Pricing

TAF1A, NT (TAF1A, TATA box-binding protein-associated factor RNA polymerase I subunit A, RNA polymerase I-specific TBP-associated factor 48kD, TATA box-binding protein-associated factor 1A, Transcription factor SL1, Transcription initiation factor SL1/TIF

MBS6353355-01 0.1 mL

TAF1A, NT (TAF1A, TATA box-binding protein-associated factor RNA polymerase I subunit A, RNA polymerase I-specific TBP-associated factor 48kD, TATA box-binding protein-associated factor 1A, Transcription factor SL1, Transcription initiation factor SL1/TIF

Sign In for Pricing

TAF1A, NT (TAF1A, TATA box-binding protein-associated factor RNA polymerase I subunit A, RNA polymerase I-specific TBP-associated factor 48kD, TATA box-binding protein-associated factor 1A, Transcription factor SL1, Transcription initiation factor SL1/TIF

MBS6353355-02 5x 0.1 mL

TAF1A, NT (TAF1A, TATA box-binding protein-associated factor RNA polymerase I subunit A, RNA polymerase I-specific TBP-associated factor 48kD, TATA box-binding protein-associated factor 1A, Transcription factor SL1, Transcription initiation factor SL1/TIF

Sign In for Pricing

Anti-CXCR4/CD184 Antibody (Ulocuplumab)

F1107-50 50 mg

Anti-CXCR4/CD184 Antibody (Ulocuplumab)

Sign In for Pricing

Rat Irf7 Pre-designed siRNA Set B

SI206865B 1 Each

Rat Irf7 Pre-designed siRNA Set B

Sign In for Pricing