Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALCOCO1 Rabbit Polyclonal Antibody (HRP)

CALCOCO1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cocoa, PP13275, calphoglin

UniProt

Q9P1Z2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CALCOCO1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065949

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Mouse CD1d Flow Cytometry Monoclonal Clone 19G11 PE/Cyanine5.5 Ready To Use 100 Tests
IRTAMSCD1D19G11CPECY55100 100 Tests

Anti Mouse CD1d Flow Cytometry Monoclonal Clone 19G11 PE/Cyanine5.5 Ready To Use 100 Tests

Sign In for Pricing
View Details
Lss AAV siRNA Pooled Vector
27759164 1.0 µg

Lss AAV siRNA Pooled Vector

Sign In for Pricing
View Details
NUDT9 CRISPRa sgRNA lentivector (set of three targets)(Human)
32306121 3x 1.0µg DNA

NUDT9 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant human DDT protein
ATGP0593-100 100 µg

Recombinant human DDT protein

Sign In for Pricing
View Details
CDC14A (NM_033313) Human Tagged ORF Clone Lentiviral Particle
RC210878L4V 200 µL

CDC14A (NM_033313) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Campylobacter jejuni (HRP)
MBS6128531-01 0.1 mL

Campylobacter jejuni (HRP)

Sign In for Pricing
View Details