Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALCOCO1 Rabbit Polyclonal Antibody (HRP)

CALCOCO1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cocoa, PP13275, calphoglin

UniProt

Q9P1Z2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CALCOCO1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065949

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CKS1 (CKS1B) Rabbit Polyclonal Antibody
TA372245 100 µL

CKS1 (CKS1B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CBWD7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0370406 1.0 µg DNA

CBWD7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human Acid Phosphatase 5, Tartrate Resistant (ACP5) ELISA Kit
MBS452176-01 48 Tests

Human Acid Phosphatase 5, Tartrate Resistant (ACP5) ELISA Kit

Sign In for Pricing
View Details
Human Acid Phosphatase 5, Tartrate Resistant (ACP5) ELISA Kit
MBS452176-02 96 Tests

Human Acid Phosphatase 5, Tartrate Resistant (ACP5) ELISA Kit

Sign In for Pricing
View Details
Human Acid Phosphatase 5, Tartrate Resistant (ACP5) ELISA Kit
MBS452176-03 5x 96 Tests

Human Acid Phosphatase 5, Tartrate Resistant (ACP5) ELISA Kit

Sign In for Pricing
View Details
Human Acid Phosphatase 5, Tartrate Resistant (ACP5) ELISA Kit
MBS452176-04 10x 96 Tests

Human Acid Phosphatase 5, Tartrate Resistant (ACP5) ELISA Kit

Sign In for Pricing
View Details