Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vat1l Rabbit Polyclonal Antibody (HRP)

Vat1l Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI427515, mKIAA1576, 9430073I07

UniProt

Q80TB8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Vat1l

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVN

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766604

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha B Crystallin (CRYAB) Rabbit Polyclonal Antibody
TA384046 100 µL

Alpha B Crystallin (CRYAB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Atp6v0a2 activation kit by CRISPRa
GA204358 1 Kit

Mouse Atp6v0a2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human G gamma12 (GNG12) activation kit by CRISPRa
GA111077 1 Kit

Human G gamma12 (GNG12) activation kit by CRISPRa

Sign In for Pricing
View Details
Human C5orf49 activation kit by CRISPRa
GA115214 1 Kit

Human C5orf49 activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin Conjugated Rabbit Anti-LcH Antibody
BAL-1401-2 2 mL

Biotin Conjugated Rabbit Anti-LcH Antibody

Sign In for Pricing
View Details
RAB6D (NM_001077637) Human Over-expression Lysate
LY421467 100 µg

RAB6D (NM_001077637) Human Over-expression Lysate

Sign In for Pricing
View Details