Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Magee1 Rabbit Polyclonal Antibody (Biotin)

Magee1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DAMA, DAMAGE, mMage-e, AI847422, mMage-e1

UniProt

Q6PCZ4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_444431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Patatin Like Phospholipase Domain Containing Protein 1 (PNPLA1) ELISA Kit
YP-W22584-01 48 Tests

Mouse Patatin Like Phospholipase Domain Containing Protein 1 (PNPLA1) ELISA Kit

Sign In for Pricing
View Details
Mouse Patatin Like Phospholipase Domain Containing Protein 1 (PNPLA1) ELISA Kit
YP-W22584-02 96 Tests

Mouse Patatin Like Phospholipase Domain Containing Protein 1 (PNPLA1) ELISA Kit

Sign In for Pricing
View Details
Phospho-HSP70 (Tyr41) Rabbit Polyclonal Antibody (APC)
orb1004187 100 µL

Phospho-HSP70 (Tyr41) Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
SPECC1L Protein Vector (Rat) (pPB-N-His)
PV307647 500 ng

SPECC1L Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Barcoded Goniometer Base B5 (10 ea)
JBS-HT-GB-B5-10 10 Each

Barcoded Goniometer Base B5 (10 ea)

Sign In for Pricing
View Details
Connective Tissue Growth Factor (CTGF) Magnetic Fluorescence Assay Kit
MBS2154309-01 96 Tests

Connective Tissue Growth Factor (CTGF) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details