Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Magee1 Rabbit Polyclonal Antibody (HRP)

Magee1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DAMA, DAMAGE, mMage-e, AI847422, mMage-e1

UniProt

Q6PCZ4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_444431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurotrophin 3 Antibody HRP Conjugated
MBS9459779-01 0.1 mL

Neurotrophin 3 Antibody HRP Conjugated

Sign In for Pricing
View Details
Neurotrophin 3 Antibody HRP Conjugated
MBS9459779-02 5x 0.1 mL

Neurotrophin 3 Antibody HRP Conjugated

Sign In for Pricing
View Details
ENaC β Rabbit Polyclonal Antibody
E28PT1551 100 µL

ENaC β Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF184 Polyclonal Antibody, FITC Conjugated
A61932-050 50 µL

ZNF184 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) EM1 Polyclonal Antibody
MBS7143519 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) EM1 Polyclonal Antibody

Sign In for Pricing
View Details
SDC3 Antibody
orb681098 100 µL

SDC3 Antibody

Sign In for Pricing
View Details