Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cpne5 Rabbit Polyclonal Antibody (FITC)

Cpne5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

A830083G22Rik

UniProt

Q8JZW4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_694806

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMEL (Melanocyte Protein PMEL, ME20-M, ME20M, Melanocyte Protein Pmel 17, Melanocytes Lineage-specific Antigen GP100, Melanoma-associated ME20 Antigen, P1, P100, Premelanosome Protein, Silver Locus Protein Homolog, D12S53E, PMEL17, SILV) (MaxLight 650)
MBS6401700-01 0.1 mL

PMEL (Melanocyte Protein PMEL, ME20-M, ME20M, Melanocyte Protein Pmel 17, Melanocytes Lineage-specific Antigen GP100, Melanoma-associated ME20 Antigen, P1, P100, Premelanosome Protein, Silver Locus Protein Homolog, D12S53E, PMEL17, SILV) (MaxLight 650)

Sign In for Pricing
View Details
PMEL (Melanocyte Protein PMEL, ME20-M, ME20M, Melanocyte Protein Pmel 17, Melanocytes Lineage-specific Antigen GP100, Melanoma-associated ME20 Antigen, P1, P100, Premelanosome Protein, Silver Locus Protein Homolog, D12S53E, PMEL17, SILV) (MaxLight 650)
MBS6401700-02 5x 0.1 mL

PMEL (Melanocyte Protein PMEL, ME20-M, ME20M, Melanocyte Protein Pmel 17, Melanocytes Lineage-specific Antigen GP100, Melanoma-associated ME20 Antigen, P1, P100, Premelanosome Protein, Silver Locus Protein Homolog, D12S53E, PMEL17, SILV) (MaxLight 650)

Sign In for Pricing
View Details
KPNA3 Polyclonal Antibody
orb618408-01 50 μL

KPNA3 Polyclonal Antibody

Sign In for Pricing
View Details
KPNA3 Polyclonal Antibody
orb618408-02 100 µL

KPNA3 Polyclonal Antibody

Sign In for Pricing
View Details
Xkr9 (NM_001011873) Mouse Tagged Lenti ORF Clone
MR224285L3 10 µg

Xkr9 (NM_001011873) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Enniatin A
GW5616-500ug 500 µg

Enniatin A

Sign In for Pricing
View Details