Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBA2 Rabbit Polyclonal Antibody (Biotin)

GBA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AD035, SPG46, NLGase

UniProt

Q9HCG7

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence MCHLRPTLRDYGRFGYLEGQEYRMYNTYDVHFYASFALIMLWPKLELSLQ

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MCHLRPTLRDYGRFGYLEGQEYRMYNTYDVHFYASFALIMLWPKLELSLQ

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

105 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_065995

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SPATA46 sgRNA gene knockout kit - Lentiviral human SPATA46 sgRNA gene knockout kit (25)
GTR15382932 1 Vial

Lentiviral human SPATA46 sgRNA gene knockout kit - Lentiviral human SPATA46 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Prnd 3'UTR GFP Stable Cell Line
TU266829 1.0 mL

Prnd 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
METTL6 (Methyltransferase like 6, MGC24132) discontinued
248697 50 µL

METTL6 (Methyltransferase like 6, MGC24132) discontinued

Sign In for Pricing
View Details
N-Propyl-8- (trifluoromethoxy) quinolin-4-amine
ABC17296-01 50 mg

N-Propyl-8- (trifluoromethoxy) quinolin-4-amine

Sign In for Pricing
View Details
N-Propyl-8- (trifluoromethoxy) quinolin-4-amine
ABC17296-02 0.5 g

N-Propyl-8- (trifluoromethoxy) quinolin-4-amine

Sign In for Pricing
View Details
Mmu-miR-6388 inhibitor
HY-RI03394-01 5 nmol

Mmu-miR-6388 inhibitor

Sign In for Pricing
View Details