Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBA2 Rabbit Polyclonal Antibody (FITC)

GBA2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AD035, SPG46, NLGase

UniProt

Q9HCG7

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence MCHLRPTLRDYGRFGYLEGQEYRMYNTYDVHFYASFALIMLWPKLELSLQ

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MCHLRPTLRDYGRFGYLEGQEYRMYNTYDVHFYASFALIMLWPKLELSLQ

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

105 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_065995

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERBB2/HER2 Monoclonal Antibody, Cy7 Conjugated
bsm-42263M-Cy7 100 µL

ERBB2/HER2 Monoclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Semaphorin 7A Rabbit Monoclonal Antibody, 1 pack = 50 µL
BAL5918 1 Each

Semaphorin 7A Rabbit Monoclonal Antibody, 1 pack = 50 µL

Sign In for Pricing
View Details
Mouse Galectin-9 Recombinant Protein
PROTO08573-01 10 µg

Mouse Galectin-9 Recombinant Protein

Sign In for Pricing
View Details
Mouse Galectin-9 Recombinant Protein
PROTO08573-02 50 µg

Mouse Galectin-9 Recombinant Protein

Sign In for Pricing
View Details
Mouse Galectin-9 Recombinant Protein
PROTO08573-03 100 µg

Mouse Galectin-9 Recombinant Protein

Sign In for Pricing
View Details
Mouse Galectin-9 Recombinant Protein
PROTO08573-04 250 µg

Mouse Galectin-9 Recombinant Protein

Sign In for Pricing
View Details