Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND1A Rabbit Polyclonal Antibody (FITC)

DENND1A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FAM31A, KIAA1608

UniProt

Q8TEH3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DENND1A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065997

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arl4a 3'UTR Luciferase Stable Cell Line
TU200885 1.0 mL

Arl4a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
LAPTM4A Protein Vector (Mouse) (pPM-C-HA)
PV195812 500 ng

LAPTM4A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ANXA2 (Annexin A2, Annexin II, Annexin-2, Calpactin I Heavy Chain, Calpactin-1 Heavy Chain, Chromobindin-8, Lipocortin II, Placental Anticoagulant Protein IV, PAP-IV, Protein I, p36, ANX2, ANX2L4, CAL1H, LPC2D) (MaxLight 490)
MBS6369919-01 0.1 mL

ANXA2 (Annexin A2, Annexin II, Annexin-2, Calpactin I Heavy Chain, Calpactin-1 Heavy Chain, Chromobindin-8, Lipocortin II, Placental Anticoagulant Protein IV, PAP-IV, Protein I, p36, ANX2, ANX2L4, CAL1H, LPC2D) (MaxLight 490)

Sign In for Pricing
View Details
ANXA2 (Annexin A2, Annexin II, Annexin-2, Calpactin I Heavy Chain, Calpactin-1 Heavy Chain, Chromobindin-8, Lipocortin II, Placental Anticoagulant Protein IV, PAP-IV, Protein I, p36, ANX2, ANX2L4, CAL1H, LPC2D) (MaxLight 490)
MBS6369919-02 5x 0.1 mL

ANXA2 (Annexin A2, Annexin II, Annexin-2, Calpactin I Heavy Chain, Calpactin-1 Heavy Chain, Chromobindin-8, Lipocortin II, Placental Anticoagulant Protein IV, PAP-IV, Protein I, p36, ANX2, ANX2L4, CAL1H, LPC2D) (MaxLight 490)

Sign In for Pricing
View Details
USP7/HAUSP, Recombinant, Human, aa208-560, His-Tag, GST-Tag discontinued
046598 100 µg

USP7/HAUSP, Recombinant, Human, aa208-560, His-Tag, GST-Tag discontinued

Sign In for Pricing
View Details
Congo Red Indicator 0.1%
COR105 500 mL

Congo Red Indicator 0.1%

Sign In for Pricing
View Details