Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND1A Rabbit Polyclonal Antibody (HRP)

DENND1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAM31A, KIAA1608

UniProt

Q8TEH3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DENND1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065997

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC II (HLA-DP) (beta chain) (Bra-14), CF640R conjugate, 0.1mg/mL
BNC401129-100 1x 100 µL

MHC II (HLA-DP) (beta chain) (Bra-14), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calbindin 1 (CALB1) (CALB1/2364), CF405S conjugate, 0.1mg/mL
BNC042364-500 1x 500 µL

Calbindin 1 (CALB1) (CALB1/2364), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD1 / PDCD1 / CD279 (PDCD1/922), CF568 conjugate, 0.1mg/mL
BNC680922-500 1x 500 µL

PD1 / PDCD1 / CD279 (PDCD1/922), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (LAMP4/824), CF568 conjugate, 0.1mg/mL
BNC680824-100 1x 100 µL

CD68 (LAMP4/824), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human VLDLR/VLDL Receptor Protein (His Tag)
PKSH031275 100 µg

Recombinant Human VLDLR/VLDL Receptor Protein (His Tag)

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD172a/b Antibody[SE5A5]
AN00317M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD172a/b Antibody[SE5A5]

Sign In for Pricing
View Details